Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17)

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum. Target Name: Hemagglutinin component of the neurotoxin complex (ha17) . Accession Number: A5HZZ5; ha17. Expression Region: 2-146aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17) is a purified Recombinant Protein.

Accession Number

A5HZZ5; ha17

Expression Region

2-146aa

Host

E. coli

Target

Hemagglutinin component of the neurotoxin complex (ha17)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Clostridium botulinum

Protein Name

Recombinant Protein

AA Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, H&L (Texas Red)
I1903-36X 1 mg

IgG, H&L (Texas Red)

Sign In for Pricing
View Details
AQP7 Human Pre-designed siRNA Set A
HY-RS00879 1 Set

AQP7 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx104267-01 100 µL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Sign In for Pricing
View Details
Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx104267-02 200 µL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Sign In for Pricing
View Details
Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody
abx104267-03 1 mL

Chromodomain Helicase DNA Binding Protein 3 (CHD3) Antibody

Sign In for Pricing
View Details
RPL17P9 3'UTR Lenti-reporter-Luc Vector
40919081 1.0 µg

RPL17P9 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details