Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta E chain (INHBE)

Recombinant Human Inhibin beta E chain (INHBE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Inhibin beta E chain (INHBE) . Accession Number: P58166; INHBE. Expression Region: 237-350aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 18.5kda. Target Synonyms: Activin beta-E chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Inhibin beta E chain (INHBE) is a purified Recombinant Protein.

Accession Number

P58166; INHBE

Expression Region

237-350aa

Host

E. coli

Target

Inhibin beta E chain (INHBE)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin beta-E chain

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to B-Cell Activating Factor (BAFF)
TRV-0003698-01 20 µL

Polyclonal Antibody to B-Cell Activating Factor (BAFF)

Sign In for Pricing
View Details
Polyclonal Antibody to B-Cell Activating Factor (BAFF)
TRV-0003698-02 100 µL

Polyclonal Antibody to B-Cell Activating Factor (BAFF)

Sign In for Pricing
View Details
Polyclonal Antibody to B-Cell Activating Factor (BAFF)
TRV-0003698-03 200 µL

Polyclonal Antibody to B-Cell Activating Factor (BAFF)

Sign In for Pricing
View Details
Polyclonal Antibody to B-Cell Activating Factor (BAFF)
TRV-0003698-04 1 mL

Polyclonal Antibody to B-Cell Activating Factor (BAFF)

Sign In for Pricing
View Details
PI3KC3, CT (E834) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 405)
MBS6333612-01 0.1 mL

PI3KC3, CT (E834) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 405)

Sign In for Pricing
View Details
PI3KC3, CT (E834) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 405)
MBS6333612-02 5x 0.1 mL

PI3KC3, CT (E834) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 405)

Sign In for Pricing
View Details