Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inhibin beta E chain (INHBE)

Recombinant Human Inhibin beta E chain (INHBE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Inhibin beta E chain (INHBE) . Accession Number: P58166; INHBE. Expression Region: 237-350aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 18.5kda. Target Synonyms: Activin beta-E chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Inhibin beta E chain (INHBE) is a purified Recombinant Protein.

Accession Number

P58166; INHBE

Expression Region

237-350aa

Host

E. coli

Target

Inhibin beta E chain (INHBE)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activin beta-E chain

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Complement component C9
E14963b 96 Tests

ELISA Kit For Complement component C9

Sign In for Pricing
View Details
Recombinant HAdV-5 Protease/L3 Protein, C-His
AP98022 50 µg

Recombinant HAdV-5 Protease/L3 Protein, C-His

Sign In for Pricing
View Details
ATF7 Blocking Peptide
MBS8225091-01 1 mg

ATF7 Blocking Peptide

Sign In for Pricing
View Details
ATF7 Blocking Peptide
MBS8225091-02 5 mg

ATF7 Blocking Peptide

Sign In for Pricing
View Details
ATF7 Blocking Peptide
MBS8225091-03 5x 5 mg

ATF7 Blocking Peptide

Sign In for Pricing
View Details
INT11/CPSF3L Rabbit Polyclonal Antibody (BF750)
orb1574336 100 µL

INT11/CPSF3L Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details