Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C chemokine receptor type 9 (CCR9) -VLPs , Active Protein

Recombinant Human C-C chemokine receptor type 9 (CCR9) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein. Purity: >95% as determined by SEC-HPLC. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-C chemokine receptor type 9 (CCR9) -VLPs. Accession Number: P51686; CCR9. Expression Region: 1-369aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 43.4kda. Target Synonyms: C-C CKR-9; CC-CKR-9; CCR-9; G-protein coupled receptor 28; GPR-9-6 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-C chemokine receptor type 9 (CCR9) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein.

Accession Number

P51686; CCR9

Expression Region

1-369aa

Host

Mammalian Cells

Target

C-C chemokine receptor type 9 (CCR9) -VLPs

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SEC-HPLC

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-C CKR-9; CC-CKR-9; CCR-9; G-protein coupled receptor 28; GPR-9-6

Species

Human (Homo sapiens)

Protein Name

MP-VLP Transmembrane Protein; Active Protein

AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DUSP14 / MKP-6 Protein (His & MBP tag)
MBS2545507-01 0.1 mg

Recombinant Human DUSP14 / MKP-6 Protein (His & MBP tag)

Sign In for Pricing
View Details
Recombinant Human DUSP14 / MKP-6 Protein (His & MBP tag)
MBS2545507-02 5x 0.1 mg

Recombinant Human DUSP14 / MKP-6 Protein (His & MBP tag)

Sign In for Pricing
View Details
Human ZIK1 (NM_001010879) AAV Particle
RC224169A1V 250 µL

Human ZIK1 (NM_001010879) AAV Particle

Sign In for Pricing
View Details
Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-UNEL-R0037-01 5x 96 Tests

Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-UNEL-R0037-02 15x 96 Tests

Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details
Human C1orf127 qPCR Primer Pair
QH64817S 200 Tests

Human C1orf127 qPCR Primer Pair

Sign In for Pricing
View Details