Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1) . Target Name: immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) . Accession Number: O12160; vpr. Expression Region: 1-96aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 18.9kda. Target Synonyms: R ORF protein; Viral protein R Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) is a purified Recombinant Protein.

Accession Number

O12160; vpr

Expression Region

1-96aa

Host

E. coli

Target

Immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

R ORF protein; Viral protein R

Species

Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1)

Protein Name

Recombinant Protein

AA Sequence

MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LYNX1 knockdown cell line
ABC-KD8816 1 Vial

Human LYNX1 knockdown cell line

Sign In for Pricing
View Details
Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing
7-05811 1 mg

Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing

Sign In for Pricing
View Details
MOT11 Polyclonal Antibody
MBS8530203-01 0.1 mg

MOT11 Polyclonal Antibody

Sign In for Pricing
View Details
MOT11 Polyclonal Antibody
MBS8530203-02 0.1 mL (AF635)

MOT11 Polyclonal Antibody

Sign In for Pricing
View Details
MOT11 Polyclonal Antibody
MBS8530203-03 0.1 mL (AF610)

MOT11 Polyclonal Antibody

Sign In for Pricing
View Details
MOT11 Polyclonal Antibody
MBS8530203-04 0.1 mL (AF405S)

MOT11 Polyclonal Antibody

Sign In for Pricing
View Details