Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1) . Target Name: immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) . Accession Number: O12160; vpr. Expression Region: 1-96aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 18.9kda. Target Synonyms: R ORF protein; Viral protein R Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr) is a purified Recombinant Protein.

Accession Number

O12160; vpr

Expression Region

1-96aa

Host

E. coli

Target

Immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

R ORF protein; Viral protein R

Species

Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1)

Protein Name

Recombinant Protein

AA Sequence

MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS1/2 Recombinant Antibody, RBITC Conjugated
bsm-62931R-RBITC-01 20 µL

PIAS1/2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PIAS1/2 Recombinant Antibody, RBITC Conjugated
bsm-62931R-RBITC-02 100 µL

PIAS1/2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PSMA5, ID (Proteasome Subunit alpha Type-5, Proteasome Zeta Chain, Macropain Zeta Chain, Multicatalytic Endopeptidase Complex Zeta Chain) (FITC) discontinued
P9076-07C-FITC 200 µL

PSMA5, ID (Proteasome Subunit alpha Type-5, Proteasome Zeta Chain, Macropain Zeta Chain, Multicatalytic Endopeptidase Complex Zeta Chain) (FITC) discontinued

Sign In for Pricing
View Details
AGN 194078
orb1710472-01 25 mg

AGN 194078

Sign In for Pricing
View Details
AGN 194078
orb1710472-02 50 mg

AGN 194078

Sign In for Pricing
View Details
AGN 194078
orb1710472-03 100 mg

AGN 194078

Sign In for Pricing
View Details