Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-14 (MMP14)

Recombinant Human Matrix metalloproteinase-14 (MMP14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Matrix metalloproteinase-14 (MMP14) . Accession Number: P50281; MMP14. Expression Region: 112-582aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 69.9kda. Target Synonyms: MMP-X1Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Matrix metalloproteinase-14 (MMP14) is a purified Recombinant Protein.

Accession Number

P50281; MMP14

Expression Region

112-582aa

Host

E. coli

Target

Matrix metalloproteinase-14 (MMP14)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MMP-X1Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2610044O15Rik sgRNA CRISPR Lentivector set (Mouse)
K3270201 3x 1.0 µg

2610044O15Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Nxpe5 shRNA (UAS) - Lentiviral mouse Nxpe5 shRNA (UAS) (100)
GTR15199482 1 Vial

Lentiviral mouse Nxpe5 shRNA (UAS) - Lentiviral mouse Nxpe5 shRNA (UAS) (100)

Sign In for Pricing
View Details
SPINK14 siRNA (Rat)
orb1827511-01 15 nmol

SPINK14 siRNA (Rat)

Sign In for Pricing
View Details
SPINK14 siRNA (Rat)
orb1827511-02 30 nmol

SPINK14 siRNA (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal PLCH2 Antibody
NBP2-68945 100 µL

Rabbit Polyclonal PLCH2 Antibody

Sign In for Pricing
View Details
Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Green - 1000 un, DNase/RNase free - ABDOS
P10356G 1000 Units/Pack

Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 2.0 mL, with EPDM ring Cap, Green - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details