Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-14 (MMP14)

Recombinant Human Matrix metalloproteinase-14 (MMP14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Matrix metalloproteinase-14 (MMP14) . Accession Number: P50281; MMP14. Expression Region: 112-582aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 69.9kda. Target Synonyms: MMP-X1Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Matrix metalloproteinase-14 (MMP14) is a purified Recombinant Protein.

Accession Number

P50281; MMP14

Expression Region

112-582aa

Host

E. coli

Target

Matrix metalloproteinase-14 (MMP14)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MMP-X1Membrane-type matrix metalloproteinase 1; MT-MMP 1; MTMMP1Membrane-type-1 matrix metalloproteinase; MT1-MMP; MT1MMP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila guanche NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)
orb2920383-01 20 µg

Recombinant Drosophila guanche NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)

Sign In for Pricing
View Details
Recombinant Drosophila guanche NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)
orb2920383-02 100 µg

Recombinant Drosophila guanche NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)

Sign In for Pricing
View Details
UBAP1 Polyclonal Antibody, Cy3 Conjugated
bs-6748R-Cy3 100 µL

UBAP1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human ERN1 ELISA Kit
MBS8427150 Inquire

Human ERN1 ELISA Kit

Sign In for Pricing
View Details
TLL2 3'UTR Lenti-reporter-Luc Vector
46767081 1.0 µg

TLL2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RPL35 (NM_007209) Human Tagged ORF Clone Lentiviral Particle
RC203088L4V 200 µL

RPL35 (NM_007209) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details