Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-2 complex subunit sigma (AP2S1)

Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: AP-2 complex subunit sigma (AP2S1) . Accession Number: P53680; AP2S1. Expression Region: 1-142aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 23.9kda. Target Synonyms: Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein.

Accession Number

P53680; AP2S1

Expression Region

1-142aa

Host

E. coli

Target

AP-2 complex subunit sigma (AP2S1)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Ras-Related Protein Rab-7A (RAB7A) ELISA Kit
MBS9365949 Inquire

Duck Ras-Related Protein Rab-7A (RAB7A) ELISA Kit

Sign In for Pricing
View Details
IRBP (A-12) : m-IgG Fc BP-HRP Bundle
sc-529840 1 Kit

IRBP (A-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit Anti Human EPS15L1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul
IRBAHUEPS15L1AP155120UL 120 µL

Rabbit Anti Human EPS15L1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul

Sign In for Pricing
View Details
CEP-33779
C08874-5mg 5 mg

CEP-33779

Sign In for Pricing
View Details
MYT1, CT (Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase, Myt1 kinase, PKMYT1, MYT1,) (MaxLight 405)
MBS6323588-01 0.1 mL

MYT1, CT (Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase, Myt1 kinase, PKMYT1, MYT1,) (MaxLight 405)

Sign In for Pricing
View Details
MYT1, CT (Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase, Myt1 kinase, PKMYT1, MYT1,) (MaxLight 405)
MBS6323588-02 5x 0.1 mL

MYT1, CT (Membrane-associated tyrosine-and threonine-specific cdc2-inhibitory kinase, Myt1 kinase, PKMYT1, MYT1,) (MaxLight 405)

Sign In for Pricing
View Details