Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-2 complex subunit sigma (AP2S1)

Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: AP-2 complex subunit sigma (AP2S1) . Accession Number: P53680; AP2S1. Expression Region: 1-142aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 23.9kda. Target Synonyms: Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein.

Accession Number

P53680; AP2S1

Expression Region

1-142aa

Host

E. coli

Target

AP-2 complex subunit sigma (AP2S1)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr65 Mouse shRNA Lentiviral Particle (Locus ID 18365)
TL501551V 500 µL Each

Olfr65 Mouse shRNA Lentiviral Particle (Locus ID 18365)

Sign In for Pricing
View Details
Jak1 Rat shRNA Lentiviral Particle (Locus ID 84598)
TL711879V 500 µL Each

Jak1 Rat shRNA Lentiviral Particle (Locus ID 84598)

Sign In for Pricing
View Details
Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [DyLight 488]
NBP2-90324G 0.1 mL

Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [DyLight 488]

Sign In for Pricing
View Details
Anti-Human CD1a Monoclonal Antibody (PE Conjugated)
MBS2558913-01 20 Tests

Anti-Human CD1a Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD1a Monoclonal Antibody (PE Conjugated)
MBS2558913-02 100 Tests

Anti-Human CD1a Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details
Anti-Human CD1a Monoclonal Antibody (PE Conjugated)
MBS2558913-03 2x 100 Tests

Anti-Human CD1a Monoclonal Antibody (PE Conjugated)

Sign In for Pricing
View Details