Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5)

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Immunoglobulin lambda-like polypeptide 5 (IGLL5) . Accession Number: B9A064; IGLL5. Expression Region: 36-214aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 21.3kda. Target Synonyms: G lambda-1 Germline immunoglobulin lambda 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein.

Accession Number

B9A064; IGLL5

Expression Region

36-214aa

Host

Yeast

Target

Immunoglobulin lambda-like polypeptide 5 (IGLL5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

G lambda-1 Germline immunoglobulin lambda 1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNASE1L2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
18429151 3x 1.0 µg DNA

DNASE1L2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit
MBS9322097-01 48 Well

Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit

Sign In for Pricing
View Details
Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit
MBS9322097-02 96 Well

Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit

Sign In for Pricing
View Details
Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit
MBS9322097-03 5x 96 Well

Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit

Sign In for Pricing
View Details
Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit
MBS9322097-04 10x 96 Well

Human Melanoma-associated antigen 5, MAGEA5 ELISA Kit

Sign In for Pricing
View Details
Flamma® 648NA NHS ester
PNS1215_5 mg 5 mg

Flamma® 648NA NHS ester

Sign In for Pricing
View Details