Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5)

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Immunoglobulin lambda-like polypeptide 5 (IGLL5) . Accession Number: B9A064; IGLL5. Expression Region: 36-214aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 21.3kda. Target Synonyms: G lambda-1 Germline immunoglobulin lambda 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) is a purified Recombinant Protein.

Accession Number

B9A064; IGLL5

Expression Region

36-214aa

Host

Yeast

Target

Immunoglobulin lambda-like polypeptide 5 (IGLL5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

G lambda-1 Germline immunoglobulin lambda 1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3152-5p miRNA Inhibitor
MIH01773 2x 5.0 nmol

hsa-miR-3152-5p miRNA Inhibitor

Sign In for Pricing
View Details
MAPK Family Antibody Sampler Kit, BioAssayTM discontinued
473960 3x20ul

MAPK Family Antibody Sampler Kit, BioAssayTM discontinued

Sign In for Pricing
View Details
RWDD3, CT (RWD-containing sumoylation enhancer, RWD domain-containing protein 3, RSUME, RWDD3) (AP) discontinued
041342-AP 200 µL

RWDD3, CT (RWD-containing sumoylation enhancer, RWD domain-containing protein 3, RSUME, RWDD3) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse 9530077C05Rik shRNA (UAS) - Lentiviral mouse 9530077C05Rik shRNA (UAS, RFP) (25)
GTR15230639 1 Vial

Lentiviral mouse 9530077C05Rik shRNA (UAS) - Lentiviral mouse 9530077C05Rik shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
NRP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV712883 1.0 µg DNA

NRP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Penaeid shrimp infectious myonecrosis virus PCR kit
PCR-V290-96R 100T

Penaeid shrimp infectious myonecrosis virus PCR kit

Sign In for Pricing
View Details