Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease 7 (RNASE7)

Recombinant Human Ribonuclease 7 (RNASE7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ribonuclease 7 (RNASE7) . Accession Number: Q9H1E1; RNASE7. Expression Region: 29-156aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 18.6kda. Target Synonyms: RNase 7; Skin-derived antimicrobial protein 2; SAP-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ribonuclease 7 (RNASE7) is a purified Recombinant Protein.

Accession Number

Q9H1E1; RNASE7

Expression Region

29-156aa

Host

E. coli

Target

Ribonuclease 7 (RNASE7)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RNase 7; Skin-derived antimicrobial protein 2; SAP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGPL1, NT (SGPL1, KIAA1252, Sphingosine-1-phosphate lyase 1, Sphingosine-1-phosphate aldolase) (MaxLight 750) discontinued
041672-ML750 100 µL

SGPL1, NT (SGPL1, KIAA1252, Sphingosine-1-phosphate lyase 1, Sphingosine-1-phosphate aldolase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KLHL25 Mouse Monoclonal Antibody [Clone ID: 1B7]
AM06471SU-N 100 µL

KLHL25 Mouse Monoclonal Antibody [Clone ID: 1B7]

Sign In for Pricing
View Details
Recombinant Human SPARC protein (SPARC), Active Protein
RPC28819-01 Inquire

Recombinant Human SPARC protein (SPARC), Active Protein

Sign In for Pricing
View Details
Recombinant Human SPARC protein (SPARC), Active Protein
RPC28819-02 100 µg

Recombinant Human SPARC protein (SPARC), Active Protein

Sign In for Pricing
View Details
PKD2L1 Human qPCR Template Standard (NM_016112)
HK205639 1 Kit

PKD2L1 Human qPCR Template Standard (NM_016112)

Sign In for Pricing
View Details
MAPKAPK2 siRNA (Mouse)
MBS8226503-01 15 nmol

MAPKAPK2 siRNA (Mouse)

Sign In for Pricing
View Details