Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial

Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Klebsiella pneumoniae (strain 342) . Target Name: Outer membrane protein assembly factor BamA (bamA) . Accession Number: B5Y1J4; bamA. Expression Region: 24-172aa. Tag Info: N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged. Theoretical MW: 33.3kda. Target Synonyms: bamA; yaeT; KPK_4543Outer membrane protein assembly factor BamA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Klebsiella pneumoniae Outer membrane protein assembly factor BamA (bamA), partial is a purified Recombinant Protein.

Accession Number

B5Y1J4; bamA

Expression Region

24-172aa

Host

E. coli

Target

Outer membrane protein assembly factor BamA (bamA)

Conjugation

Unconjugated

Tag

N-Terminal 10XHis-B2M-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BamA; yaeT; KPK_4543Outer membrane protein assembly factor BamA

Species

Klebsiella pneumoniae (strain 342)

Protein Name

Recombinant Protein

AA Sequence

FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD49a/ITGA1 Antibody (AQC2), PerCP
HX227147-01 1 Each

Anti-Human CD49a/ITGA1 Antibody (AQC2), PerCP

Sign In for Pricing
View Details
Anti-Human CD49a/ITGA1 Antibody (AQC2), PerCP
HX227147-02 100 Tests

Anti-Human CD49a/ITGA1 Antibody (AQC2), PerCP

Sign In for Pricing
View Details
Pnpla6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4837408 1.0 µg DNA

Pnpla6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Sh3rf2 shRNA (UAS) - Lentiviral mouse Sh3rf2 shRNA (UAS, iRFP) plasmid
GTR15304123 1 Vial

Lentiviral mouse Sh3rf2 shRNA (UAS) - Lentiviral mouse Sh3rf2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CLPTM1, ID (CLPTM1, Cleft lip and palate transmembrane protein 1) (MaxLight 405)
MBS6286893-01 0.1 mL

CLPTM1, ID (CLPTM1, Cleft lip and palate transmembrane protein 1) (MaxLight 405)

Sign In for Pricing
View Details
CLPTM1, ID (CLPTM1, Cleft lip and palate transmembrane protein 1) (MaxLight 405)
MBS6286893-02 5x 0.1 mL

CLPTM1, ID (CLPTM1, Cleft lip and palate transmembrane protein 1) (MaxLight 405)

Sign In for Pricing
View Details