Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein

Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: CD93 molecule (CD93) . Accession Number: A0A2K5VH53; CD93. Expression Region: 24-581aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 60.2kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis CD93 molecule (CD93), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

A0A2K5VH53; CD93

Expression Region

24-581aa

Host

Mammalian Cells

Target

CD93 molecule (CD93)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

60.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pdrg1 Pre-designed siRNA Set B
SI110337B 1 Each

Mouse Pdrg1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit
MBS8820155-01 48 Well

Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit

Sign In for Pricing
View Details
Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit
MBS8820155-02 96 Well

Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit

Sign In for Pricing
View Details
Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit
MBS8820155-03 5x 96 Well

Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit

Sign In for Pricing
View Details
Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit
MBS8820155-04 10x 96 Well

Human Anti-AChR (Anti-Acetylcholine Receptor Antibody) ELISA Kit

Sign In for Pricing
View Details
Vmn2r10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3133008 1.0 µg DNA

Vmn2r10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details