Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor 1 receptor (IGF1R) . Accession Number: P08069; IGF1R. Expression Region: 763-931aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 46.4kda. Target Synonyms: Insulin-like growth factor I receptor; IGF-I receptor; CD221 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein.

Accession Number

P08069; IGF1R

Expression Region

763-931aa

Host

E. coli

Target

Insulin-like growth factor 1 receptor (IGF1R)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Insulin-like growth factor I receptor; IGF-I receptor; CD221

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

THTPA Mouse Monoclonal Antibody [Clone ID: LBI4C11]
AMM17221VCF 100 µg

THTPA Mouse Monoclonal Antibody [Clone ID: LBI4C11]

Ask
View Details
ULBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49158111 3x 1.0 µg

ULBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
GCM1 Mouse Monoclonal Antibody [Clone ID: LBI4H6]
AMM19683VCF 100 µg

GCM1 Mouse Monoclonal Antibody [Clone ID: LBI4H6]

Ask
View Details
Dynactin 1, NT (150kD Dynein Associated Polypeptide, 150kD Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1 HUMAN, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), Dynactin 1 (p150 Glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 Glued, p150 Glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-Glued, p150Glued)
381605 100 µL

Dynactin 1, NT (150kD Dynein Associated Polypeptide, 150kD Dynein-Associated Polypeptide, DAP 150, DAP-150, DAP150, DCTN 1, DCTN1, DCTN1 HUMAN, DP 150, DP-150, DP150, Dynactin 1 (p150 Glued (Drosophila) Homolog), Dynactin 1 (p150 Glued Homolog Drosophila), Dynactin 1, Dynactin Subunit 1, Dynactin1, HMN7B, p135, p150 Glued (Drosophila) Homolog, p150 Glued, p150 Glued Homolog, p150 (GLUED) DROSOPHILA Homolog OF, p150-Glued, p150Glued)

Ask
View Details