Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor 1 receptor (IGF1R) . Accession Number: P08069; IGF1R. Expression Region: 763-931aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 46.4kda. Target Synonyms: Insulin-like growth factor I receptor; IGF-I receptor; CD221 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein.

Accession Number

P08069; IGF1R

Expression Region

763-931aa

Host

E. coli

Target

Insulin-like growth factor 1 receptor (IGF1R)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Insulin-like growth factor I receptor; IGF-I receptor; CD221

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Transmembrane Protease, Serine 6 ELISA Kit
MBS103604 Inquire

Donkey Transmembrane Protease, Serine 6 ELISA Kit

Sign In for Pricing
View Details
KBTBD8 Human shRNA Plasmid Kit (Locus ID 84541)
TR303837 1 Kit

KBTBD8 Human shRNA Plasmid Kit (Locus ID 84541)

Sign In for Pricing
View Details
Anti-SNRNP40 Antibody Picoband® Fluoro594 Conjugated
A12991-2-Fluoro594 100 µg/Vial

Anti-SNRNP40 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Phospho-FRS2 (Tyr436) Rabbit Polyclonal Antibody (Cy3)
orb990369 100 µL

Phospho-FRS2 (Tyr436) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Clca3a1 (NM_009899) Mouse Tagged ORF Clone
MR223065 10 µg

Clca3a1 (NM_009899) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal SFRS3 Antibody [mFluor Violet 610 SE]
NBP2-41316MFV610 0.1 mL

Rabbit Polyclonal SFRS3 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details