Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor 1 receptor (IGF1R) . Accession Number: P08069; IGF1R. Expression Region: 763-931aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 46.4kda. Target Synonyms: Insulin-like growth factor I receptor; IGF-I receptor; CD221 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial is a purified Recombinant Protein.

Accession Number

P08069; IGF1R

Expression Region

763-931aa

Host

E. coli

Target

Insulin-like growth factor 1 receptor (IGF1R)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Insulin-like growth factor I receptor; IGF-I receptor; CD221

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3C2A Rabbit Polyclonal Antibody (Biotin)
orb2090863 100 µL

PIK3C2A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LH, alpha (Luteinizing Hormone, alpha) Antibody
orb1711877 1 mL

LH, alpha (Luteinizing Hormone, alpha) Antibody

Sign In for Pricing
View Details
Microphthalmia (Transcription Factor, MiTF) (BSA & Azide Free) discontinued
M3891X-ML750 100 µL

Microphthalmia (Transcription Factor, MiTF) (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
NPPC/Atrial natriuretic peptide Rabbit Polyclonal Antibody (Cy3)
orb987637 100 µL

NPPC/Atrial natriuretic peptide Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SIM2 Antibody, HRP conjugated
MBS7107256-01 0.05 mg

SIM2 Antibody, HRP conjugated

Sign In for Pricing
View Details
SIM2 Antibody, HRP conjugated
MBS7107256-02 0.1 mg

SIM2 Antibody, HRP conjugated

Sign In for Pricing
View Details