Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-4 (IL4)

Recombinant Lama glama Interleukin-4 (IL4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Lama glama (Llama) . Target Name: Interleukin-4 (IL4) . Accession Number: Q865X5; IL4. Expression Region: 25-133aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 13.8kda. Target Synonyms: IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Lama glama Interleukin-4 (IL4) is a purified Recombinant Protein.

Accession Number

Q865X5; IL4

Expression Region

25-133aa

Host

Yeast

Target

Interleukin-4 (IL4)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1

Species

Lama glama (Llama)

Protein Name

Recombinant Protein

AA Sequence

HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2 Protein Vector (Human) (pPM-C-HA)
11167021 500 ng

ACE2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tubb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6456506 1.0 µg DNA

Tubb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Sex Determining Region Y Box Protein 17 (SOX17) Antibody
abx008065-01 30 µL

Sex Determining Region Y Box Protein 17 (SOX17) Antibody

Sign In for Pricing
View Details
Sex Determining Region Y Box Protein 17 (SOX17) Antibody
abx008065-02 100 µL

Sex Determining Region Y Box Protein 17 (SOX17) Antibody

Sign In for Pricing
View Details
Sex Determining Region Y Box Protein 17 (SOX17) Antibody
abx008065-03 200 µL

Sex Determining Region Y Box Protein 17 (SOX17) Antibody

Sign In for Pricing
View Details
OR1J4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1487908 1.0 µg DNA

OR1J4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details