Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3)

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: Cell wall mannoprotein CIS3 (CIS3) . Accession Number: P47001; CIS3. Expression Region: 65-227aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.3kda. Target Synonyms: Covalently-linked cell wall protein 5/11; Protein with internal repeats 4; Soluble cell wall protein 8 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3) is a purified Recombinant Protein.

Accession Number

P47001; CIS3

Expression Region

65-227aa

Host

E. coli

Target

Cell wall mannoprotein CIS3 (CIS3)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Covalently-linked cell wall protein 5/11; Protein with internal repeats 4; Soluble cell wall protein 8

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

DVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DBC1/p30 Antibody (PCRP-KIAA1967-1D10) [Alexa Fluor 700]
NBP3-24324AF700 0.1 mL

Mouse Monoclonal DBC1/p30 Antibody (PCRP-KIAA1967-1D10) [Alexa Fluor 700]

Sign In for Pricing
View Details
Chicken Tumor Necrosis Factor Receptor Superfamily Member 11A / RANK (TNFRSF11A) ELISA Kit
abx356367 96 Well

Chicken Tumor Necrosis Factor Receptor Superfamily Member 11A / RANK (TNFRSF11A) ELISA Kit

Sign In for Pricing
View Details
Nr1d1 3'UTR GFP Stable Cell Line
TU264156 1.0 mL

Nr1d1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
COPS8 (NM_006710) Human Over-expression Lysate
LS010920-20ug 20 µg

COPS8 (NM_006710) Human Over-expression Lysate

Sign In for Pricing
View Details
Protor 1 (PRR5) (NM_001198721) Human Tagged ORF Clone Lentiviral Particle
RC231217L3V 200 µL

Protor 1 (PRR5) (NM_001198721) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HTATIP2 Knockout 786-O Polyclonal Cells
ARG25303 1 Million

HTATIP2 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details