Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3)

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: Cell wall mannoprotein CIS3 (CIS3) . Accession Number: P47001; CIS3. Expression Region: 65-227aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.3kda. Target Synonyms: Covalently-linked cell wall protein 5/11; Protein with internal repeats 4; Soluble cell wall protein 8 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae Cell wall mannoprotein CIS3 (CIS3) is a purified Recombinant Protein.

Accession Number

P47001; CIS3

Expression Region

65-227aa

Host

E. coli

Target

Cell wall mannoprotein CIS3 (CIS3)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Covalently-linked cell wall protein 5/11; Protein with internal repeats 4; Soluble cell wall protein 8

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

DVISQIGDGQVQATSAATAQATDSQAQATTTATPTSSEKISSSASKTSTNATSSSCATPSLKDSSCKNSGTLELTLKDGVLTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITEDGYLALGDSDVFYQCLSGNFYNLYDQNVAEQCSAIHLEAVSLVDC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV691891 1.0 µg DNA

TRPM8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Fmoc-3-fluoro-L-beta-homophenylalanine
sc-294739A 250 mg

Fmoc-3-fluoro-L-beta-homophenylalanine

Sign In for Pricing
View Details
P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: LBI1E7]
AMM16982VCF 100 µg

P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: LBI1E7]

Sign In for Pricing
View Details
CBX5 (Chromobox Homolog 5, Drosophila HP1 alpha Homolog) discontinued
C2098-85 50 µg

CBX5 (Chromobox Homolog 5, Drosophila HP1 alpha Homolog) discontinued

Sign In for Pricing
View Details
Polyclonal Antibody to Bilirubin (Bb)
MBS2017097-01 0.1 mL

Polyclonal Antibody to Bilirubin (Bb)

Sign In for Pricing
View Details
Polyclonal Antibody to Bilirubin (Bb)
MBS2017097-02 0.2 mL

Polyclonal Antibody to Bilirubin (Bb)

Sign In for Pricing
View Details