Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Potassium voltage-gated channel subfamily A member 1 protein (KCNA1), partial

Recombinant Human Potassium voltage-gated channel subfamily A member 1 protein (KCNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Potassium voltage-gated channel subfamily A member 1 protein (KCNA1) . Accession Number: Q09470; KCNA1. Expression Region: 1-154aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 22.2kda. Target Synonyms: Voltage-gated K (+) channel HuKI1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Potassium voltage-gated channel subfamily A member 1 protein (KCNA1), partial is a purified Recombinant Protein.

Accession Number

Q09470; KCNA1

Expression Region

1-154aa

Host

E. coli

Target

Potassium voltage-gated channel subfamily A member 1 protein (KCNA1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Voltage-gated K (+) channel HuKI1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luria Bertani HiVeg® Agar, Miller, Granulated (Miller Luria
Bertani HiVeg® Agar, Granulated)
GMV1151-500G 500 g

Luria Bertani HiVeg® Agar, Miller, Granulated (Miller Luria
Bertani HiVeg® Agar, Granulated)

Sign In for Pricing
View Details
fast skeletal Myosin (MYLPF) Human shRNA Plasmid Kit (Locus ID 29895)
TL315648 1 Kit

fast skeletal Myosin (MYLPF) Human shRNA Plasmid Kit (Locus ID 29895)

Sign In for Pricing
View Details
C9orf72 Monoclonal Antibody
E53M01882 100 µL

C9orf72 Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Aldh3a1 shRNA (UAS) - Lentiviral mouse Aldh3a1 shRNA (UAS, iRFP) plasmid
GTR15261520 1 Vial

Lentiviral mouse Aldh3a1 shRNA (UAS) - Lentiviral mouse Aldh3a1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
S100A9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV675344 1.0 µg DNA

S100A9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SERP1 3'UTR GFP Stable Cell Line
TU072941 1.0 mL

SERP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details