Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs , Active Protein

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tetraspanin-8 (TSPAN8) -VLPs. Accession Number: P19075; TSPAN8-VLPs. Expression Region: 1-237aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 27.4kda. Target Synonyms: Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein.

Accession Number

P19075; TSPAN8-VLPs

Expression Region

1-237aa

Host

Mammalian Cells

Target

Tetraspanin-8 (TSPAN8) -VLPs

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

The purity information is not available for VLPs proteins

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029

Species

Human (Homo sapiens)

Protein Name

MP-VLP Transmembrane Protein; Active Protein

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fibronectin (FN1) (NM_054034) Human 3' UTR Clone
SC201610 10 µg

Fibronectin (FN1) (NM_054034) Human 3' UTR Clone

Ask
View Details
SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) (APC)
133536-APC 100 µL

SMAD1 (Mothers Against Decapentaplegic Homolog 1, Mothers Against DPP Homolog 1, MAD Homolog 1, MADH1, SMAD Family Member 1, SMAD 1, hSMAD1, BSP-1, BSP1, JV4-1, JV41, Mad-related Protein 1, MADR1, Transforming Growth Factor-beta-signaling Protein 1) (APC)

Ask
View Details
RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugating Enzyme 7-interacting Protein 3) (MaxLight 750) discontinued
132375-ML750 100 µL

RBCK1 (C20orf18, RNF54, UBCE7IP3, XAP3, XAP4, RanBP-type and C3HC4-type Zinc Finger-containing Protein 1, HBV-associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, Hepatitis B Virus X-associated Protein 4, RING Finger Protein 54, Ubiquitin-conjugating Enzyme 7-interacting Protein 3) (MaxLight 750) discontinued

Ask
View Details
Mouse Monoclonal HBsAg Antibody (1044/329) [DyLight 488]
NB100-64554G 0.1 mL

Mouse Monoclonal HBsAg Antibody (1044/329) [DyLight 488]

Ask
View Details