Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated

Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human parechovirus 5 (strain CT86-6760) (HPeV-5) (Echovirus 23) . Target Name: parechovirus 2 Genome polyprotein, Biotinylated. Accession Number: Q9YID8; N/A. Expression Region: 1-290aa. Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged. Theoretical MW: 79.6kda. Target Synonyms: P1AB; Virion protein 0; P1C; Virion protein 3; P1D; Virion protein 1; P2A; Protein 2A; P2B; P2C; P3A; VPg; Protein 3B; P3B; P3C; Picornain 3C; P3D-POL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated is a purified Recombinant Protein.

Accession Number

Q9YID8; N/A

Expression Region

1-290aa

Host

E. coli

Target

Parechovirus 2 Genome polyprotein, Biotinylated

Conjugation

Unconjugated

Tag

N-Terminal MBP-Tagged and C-Terminal 6xHis-Avi-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

79.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P1AB; Virion protein 0; P1C; Virion protein 3; P1D; Virion protein 1; P2A; Protein 2A; P2B; P2C; P3A; VPg; Protein 3B; P3B; P3C; Picornain 3C; P3D-POL

Species

Human parechovirus 5 (strain CT86-6760) (HPeV-5) (Echovirus 23)

Protein Name

Recombinant Protein

AA Sequence

METIKSIADMATGFTNTIDSTVNAVTEGVSKIGNDSGGEILTKVADDASNLLGPNCVASTSQPENKDVVQATTTVNTLTNLTQHPSAPTMPFTPDFSNVDVFHSMAYDITTGDKNPSKLIRLDTTTWQHTWPRQHLINDVELPKAFWDKNSKPAYGQSRYFAAVRCGFHFQVQINVNQGTAGCALVVYEPKPIVTHGGHLEFGSYTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDLGRLRVYVWTPLTIPSSATNDVDVTVLGSLLQLDFQNPRTYDTDVNIYDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
12110126 3x 1.0µg DNA

AP2S1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Zebrafish PROX1a Rabbit Polyclonal Antibody (FITC)
orb2817654 100 µg

Zebrafish PROX1a Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HLA-DRB1 Polyclonal Antibody, FITC Conjugated
A52028-050 50 µL

HLA-DRB1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal DNA polymerase delta p50 Antibody
NBP2-32093 100 µL

Rabbit Polyclonal DNA polymerase delta p50 Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum rbfA Protein (aa 1-168)
VAng-Yyj3965-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Gilvum rbfA Protein (aa 1-168)

Sign In for Pricing
View Details
Horse T-Cell Surface Glycoprotein CD4 (CD4) ELISA Kit
MBS9945359-01 48 Well

Horse T-Cell Surface Glycoprotein CD4 (CD4) ELISA Kit

Sign In for Pricing
View Details