Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain PAK) . Target Name: Type IV pilus biogenesis factor PilY1 (pilY1) . Accession Number: S0HPF7; pilY1. Expression Region: 610-970aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 46.2kda. Target Synonyms: Pilus-associated adhesin PilY Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial is a purified Recombinant Protein.

Accession Number

S0HPF7; pilY1

Expression Region

610-970aa

Host

E. coli

Target

Type IV pilus biogenesis factor PilY1 (pilY1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pilus-associated adhesin PilY

Species

Pseudomonas aeruginosa (strain PAK)

Protein Name

Recombinant Protein

AA Sequence

KGQDRVAFLRGDRSKENSDNFRTRNSILGDIINSSPATVGKAQYLTYLAQPIEPSGNYSTFAEAQKTRAPRVYVGANDGMLHGFDTDGNETFAFIPSAVFEKLHKLTARGYQGGAHQFYVDGSPVVADAFFGGAWHTVLIGSLRAGGKGLFALDVTDPANIKLLWEIGVDQEPDLGYSFPKPTVARLHNGKWAVVTGNGYSSLNDKAALLIIDLETGAITRKLEVTGRTGVPNGLSSPRLADNNSDGVADYAYAGDLQGNLWRFDLIAGKVNQDDPFSRANDGPAVASSFRVSFGGQPLYSAVDSAGAAQAITAAPSLVRHPTRKGYIVIFGTGKYFENADARADTSRAQTLYGIWDQQTK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Herpes Virus-5 IgM Antibody ELISA Kit, Monkey
VACY-1022-CY275 1 Kit

Human Herpes Virus-5 IgM Antibody ELISA Kit, Monkey

Sign In for Pricing
View Details
CCDC58P1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0377603 1.0 µg DNA

CCDC58P1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat Monoclonal GITR Ligand/TNFSF18 Antibody (994572) [FITC]
FAB21774F 0.1 mL

Rat Monoclonal GITR Ligand/TNFSF18 Antibody (994572) [FITC]

Sign In for Pricing
View Details
Lentiviral human NFKB1 shRNA (UAS) - Lentiviral human NFKB1 shRNA (UAS) (25)
GTR15141545 1 Vial

Lentiviral human NFKB1 shRNA (UAS) - Lentiviral human NFKB1 shRNA (UAS) (25)

Sign In for Pricing
View Details
SKP1A (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,
MBS6224659-01 0.1 mL

SKP1A (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,

Sign In for Pricing
View Details
SKP1A (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,
MBS6224659-02 5x 0.1 mL

SKP1A (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,

Sign In for Pricing
View Details