Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain PAK) . Target Name: Type IV pilus biogenesis factor PilY1 (pilY1) . Accession Number: S0HPF7; pilY1. Expression Region: 610-970aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 46.2kda. Target Synonyms: Pilus-associated adhesin PilY Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudomonas aeruginosa Type IV pilus biogenesis factor PilY1 (pilY1), partial is a purified Recombinant Protein.

Accession Number

S0HPF7; pilY1

Expression Region

610-970aa

Host

E. coli

Target

Type IV pilus biogenesis factor PilY1 (pilY1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pilus-associated adhesin PilY

Species

Pseudomonas aeruginosa (strain PAK)

Protein Name

Recombinant Protein

AA Sequence

KGQDRVAFLRGDRSKENSDNFRTRNSILGDIINSSPATVGKAQYLTYLAQPIEPSGNYSTFAEAQKTRAPRVYVGANDGMLHGFDTDGNETFAFIPSAVFEKLHKLTARGYQGGAHQFYVDGSPVVADAFFGGAWHTVLIGSLRAGGKGLFALDVTDPANIKLLWEIGVDQEPDLGYSFPKPTVARLHNGKWAVVTGNGYSSLNDKAALLIIDLETGAITRKLEVTGRTGVPNGLSSPRLADNNSDGVADYAYAGDLQGNLWRFDLIAGKVNQDDPFSRANDGPAVASSFRVSFGGQPLYSAVDSAGAAQAITAAPSLVRHPTRKGYIVIFGTGKYFENADARADTSRAQTLYGIWDQQTK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPH2 Human Pre-designed siRNA Set A
HY-RS14933 1 Set

TPH2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPS2P27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2001706 1.0 µg DNA

RPS2P27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GOLM1 (Golgi Membrane Protein 1, Golgi Membrane Protein GP73, Golgi Phosphoprotein 2, C9orf155, GOLPH2, PSEC0242, UNQ686/PRO1326, FLJ22634, FLJ23608) (MaxLight 550)
127464-ML550 100 µL

GOLM1 (Golgi Membrane Protein 1, Golgi Membrane Protein GP73, Golgi Phosphoprotein 2, C9orf155, GOLPH2, PSEC0242, UNQ686/PRO1326, FLJ22634, FLJ23608) (MaxLight 550)

Sign In for Pricing
View Details
3BHS2 Polyclonal Antibody
RA30913-01 50 µL

3BHS2 Polyclonal Antibody

Sign In for Pricing
View Details
3BHS2 Polyclonal Antibody
RA30913-02 100 µL

3BHS2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal WTAP Antibody [Alexa Fluor 405]
NBP2-99848AF405 0.1 mL

Rabbit Polyclonal WTAP Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details