Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacteroides abscessus subsp. abscessus ESAT-6-like protein (SAMEA2071181_01128)

Recombinant Mycobacteroides abscessus subsp. abscessus ESAT-6-like protein (SAMEA2071181_01128) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacteroides abscessus subsp. abscessus. Target Name: ESAT-6-like protein (SAMEA2071181_01128) . Accession Number: A0A1N3W156; SAMEA2071181_01128. Expression Region: 1-92aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 18.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacteroides abscessus subsp. abscessus ESAT-6-like protein (SAMEA2071181_01128) is a purified Recombinant Protein.

Accession Number

A0A1N3W156; SAMEA2071181_01128

Expression Region

1-92aa

Host

E. coli

Target

ESAT-6-like protein (SAMEA2071181_01128)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mycobacteroides abscessus subsp. abscessus

Protein Name

Recombinant Protein

AA Sequence

MAVFQNDLALLDSTAKKIDGKYQEFTAMQSQLRDRVAVGTSTWQGQARHAFDEAMARFDQEMGDIQKVLIGIHDTMESNKRRIQEMDESQTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfo-Cy5.5 dUTP
HY-D2224 1 Each

Sulfo-Cy5.5 dUTP

Sign In for Pricing
View Details
THEM4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46649124 3x 1.0µg DNA

THEM4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TICAM2 Protein Lysate (Human) with C-Ha Tag
46691031 100 µg

TICAM2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
AKR1D1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0069004 1.0 µg DNA

AKR1D1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Magnifier x 3 for CC-200
COL3223 1 Each

Magnifier x 3 for CC-200

Sign In for Pricing
View Details
undefined - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
TL319334 5 µg/Vial

undefined - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Sign In for Pricing
View Details