Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated

Recombinant E. coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: UPF0304 protein yfbU (yfbU), Biotinylated. Accession Number: P0A8W9; yfbU. Expression Region: 1-164aa. Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged. Theoretical MW: 67.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli O6:H1 UPF0304 protein yfbU (yfbU), Biotinylated is a purified Recombinant Protein.

Accession Number

P0A8W9; yfbU

Expression Region

1-164aa

Host

E. coli

Target

UPF0304 protein yfbU (yfbU), Biotinylated

Conjugation

Unconjugated

Tag

N-Terminal MBP-Tagged and C-Terminal 6xHis-Avi-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF568 conjugate, 0.1mg/mL
BNC682867-500 1x 500 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL
BNC042428-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details