Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Respiratory nitrate reductase 1 alpha chain (narG), partial

Recombinant E. coli Respiratory nitrate reductase 1 alpha chain (narG), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: Respiratory nitrate reductase 1 alpha chain (narG) . Accession Number: P09152; narG. Expression Region: 1-110aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 20.5kda. Target Synonyms: Nitrate reductase A subunit alpha; Quinol-nitrate oxidoreductase subunit alpha Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Respiratory nitrate reductase 1 alpha chain (narG), partial is a purified Recombinant Protein.

Accession Number

P09152; narG

Expression Region

1-110aa

Host

E. coli

Target

Respiratory nitrate reductase 1 alpha chain (narG)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nitrate reductase A subunit alpha; Quinol-nitrate oxidoreductase subunit alpha

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Polyethylene Glycol (PEG) ELISA
KLU0291 1x 96 Well

GENLISA Polyethylene Glycol (PEG) ELISA

Sign In for Pricing
View Details
Nanobacteria Removal Complete Medium (RPMI-1640, with 20%FBS)
MBS2570261-01 100 mL

Nanobacteria Removal Complete Medium (RPMI-1640, with 20%FBS)

Sign In for Pricing
View Details
Nanobacteria Removal Complete Medium (RPMI-1640, with 20%FBS)
MBS2570261-02 5x 100 mL

Nanobacteria Removal Complete Medium (RPMI-1640, with 20%FBS)

Sign In for Pricing
View Details
Tmem44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3133607 1.0 µg DNA

Tmem44 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ugt1a2 Protein Vector (Rat) (pPM-C-His)
PV314381 500 ng

Ugt1a2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Mmu-miR-343 agomir
HY-R03038A-01 5 nmol

Mmu-miR-343 agomir

Sign In for Pricing
View Details