Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83)

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus) . Target Name: herpesvirus 6A Putative CC-type chemokine U83 (U83) . Accession Number: P52460; U83. Expression Region: 1-97aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 17.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83) is a purified Recombinant Protein.

Accession Number

P52460; U83

Expression Region

1-97aa

Host

E. coli

Target

Herpesvirus 6A Putative CC-type chemokine U83 (U83)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Protein Name

Recombinant Protein

AA Sequence

MAIGFICSSPDAELFSEKSRMSSSVLLGCLLCCMDWSAAVPGKTEPFRKLFDAIMIKKLKSCSAAYPSDLDEGSMCDMADASPTSLELGLSKLDKES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor) (HRP)
MBS6155064-01 0.1 mL

SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor) (HRP)

Sign In for Pricing
View Details
SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor) (HRP)
MBS6155064-02 5x 0.1 mL

SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor) (HRP)

Sign In for Pricing
View Details
Syndecan 1 Rabbit pAb
MBS8543241-01 0.1 mL

Syndecan 1 Rabbit pAb

Sign In for Pricing
View Details
Syndecan 1 Rabbit pAb
MBS8543241-02 0.1 mL (AF405L)

Syndecan 1 Rabbit pAb

Sign In for Pricing
View Details
Syndecan 1 Rabbit pAb
MBS8543241-03 0.1 mL (AF405S)

Syndecan 1 Rabbit pAb

Sign In for Pricing
View Details
Syndecan 1 Rabbit pAb
MBS8543241-04 0.1 mL (AF610)

Syndecan 1 Rabbit pAb

Sign In for Pricing
View Details