Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83)

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus) . Target Name: herpesvirus 6A Putative CC-type chemokine U83 (U83) . Accession Number: P52460; U83. Expression Region: 1-97aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 17.3kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 6A Putative CC-type chemokine U83 (U83) is a purified Recombinant Protein.

Accession Number

P52460; U83

Expression Region

1-97aa

Host

E. coli

Target

Herpesvirus 6A Putative CC-type chemokine U83 (U83)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Protein Name

Recombinant Protein

AA Sequence

MAIGFICSSPDAELFSEKSRMSSSVLLGCLLCCMDWSAAVPGKTEPFRKLFDAIMIKKLKSCSAAYPSDLDEGSMCDMADASPTSLELGLSKLDKES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)
MBS7038847-01 0.02 mg

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)
MBS7038847-02 0.1 mg

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)
MBS7038847-03 5x 0.1 mg

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG319 homolog (MPN_454)

Sign In for Pricing
View Details
Rabbit Fc Receptor-Like A (FCRLA) ELISA Kit
MBS9902348 Inquire

Rabbit Fc Receptor-Like A (FCRLA) ELISA Kit

Sign In for Pricing
View Details
APC-Linked Anti-Cluster Of Differentiation 8a (CD8a) Polyclonal Antibody
MBS2126884-01 0.2 mL

APC-Linked Anti-Cluster Of Differentiation 8a (CD8a) Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Anti-Cluster Of Differentiation 8a (CD8a) Polyclonal Antibody
MBS2126884-02 5x 0.2 mL

APC-Linked Anti-Cluster Of Differentiation 8a (CD8a) Polyclonal Antibody

Sign In for Pricing
View Details