Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Regenerating islet-derived protein 3-beta (Reg3b) . Accession Number: P35230; Reg3b. Expression Region: 38-175aa. Tag Info: Tag-Free. Theoretical MW: 15.6kda. Target Synonyms: REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta; Reg III-beta Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) is a purified Recombinant Protein.

Accession Number

P35230; Reg3b

Expression Region

38-175aa

Host

E. coli

Target

Regenerating islet-derived protein 3-beta (Reg3b)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta; Reg III-beta

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL (Cas-Br-M (murine) Ecotropic Retroviral Transforming Sequence, C-CBL, CBL2, RNF55)
244257 100 µL

CBL (Cas-Br-M (murine) Ecotropic Retroviral Transforming Sequence, C-CBL, CBL2, RNF55)

Sign In for Pricing
View Details
Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb
M3559-01 20 µL

Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb

Sign In for Pricing
View Details
Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb
M3559-02 50 μL

Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb

Sign In for Pricing
View Details
Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb
M3559-03 100 µL

Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb

Sign In for Pricing
View Details
Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb
M3559-04 200 µL

Histone H2A (Ubiquityl Lys119) (AB1615) Rabbit mAb

Sign In for Pricing
View Details
Goat Dog IgE Heavy Chain Antibody (Biotin)
orb1520169 1 mg

Goat Dog IgE Heavy Chain Antibody (Biotin)

Sign In for Pricing
View Details