Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dermatophagoides pteronyssinus (European house dust mite) . Target Name: Major mite allergen Der p 23. Accession Number: L7N6F8; N/A. Expression Region: 22-90aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 13.0kda. Target Synonyms: Major house dust mite allergen Der p 23; Major HDM allergen Der p 23; Peritrophin-like protein Der p 23 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23 is a purified Recombinant Protein.

Accession Number

L7N6F8; N/A

Expression Region

22-90aa

Host

E. coli

Target

Major mite allergen Der p 23

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major house dust mite allergen Der p 23; Major HDM allergen Der p 23; Peritrophin-like protein Der p 23

Species

Dermatophagoides pteronyssinus (European house dust mite)

Protein Name

Recombinant Protein

AA Sequence

ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pUC-PDX1 Plasmid
PVT45705 2 µg

pUC-PDX1 Plasmid

Sign In for Pricing
View Details
TCF20 Protein Vector (Mouse) (pPM-C-HA)
46378025 500 ng

TCF20 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Hoxc10 Recombinant Protein (Mouse)
RP142214 100 µg

Hoxc10 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CCDC84 sgRNA CRISPR Lentivector (Human) (Target 1)
K0380402 1.0 µg DNA

CCDC84 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
OR3A4 Polyclonal Antibody
ABP59698-01 30 µL

OR3A4 Polyclonal Antibody

Sign In for Pricing
View Details
OR3A4 Polyclonal Antibody
ABP59698-02 100 µL

OR3A4 Polyclonal Antibody

Sign In for Pricing
View Details