Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup)

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes. Target Name: DNA-binding protein HU (hup) . Accession Number: P0C0H2; hup. Expression Region: 1-91aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.1kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Streptococcus pyogenes DNA-binding protein HU (hup) is a purified Recombinant Protein.

Accession Number

P0C0H2; hup

Expression Region

1-91aa

Host

E. coli

Target

DNA-binding protein HU (hup)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Streptococcus pyogenes

Protein Name

Recombinant Protein

AA Sequence

MANKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LITD1 Rabbit Polyclonal Antibody (Cy5)
orb947383 100 µL

LITD1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Human aryl hydrocarbon receptor,AhR ELISA Kit
CN-04573H1 96T

Human aryl hydrocarbon receptor,AhR ELISA Kit

Sign In for Pricing
View Details
Canine Bifunctional heparan sulfate N deacetylase/N sulfotransferase 3 (NDST3) ELISA kit
GTR10391411 96 Well

Canine Bifunctional heparan sulfate N deacetylase/N sulfotransferase 3 (NDST3) ELISA kit

Sign In for Pricing
View Details
Recombinant Death Associated Protein 3 (DAP3)
TRV-0041070-01 10 µg

Recombinant Death Associated Protein 3 (DAP3)

Sign In for Pricing
View Details
Recombinant Death Associated Protein 3 (DAP3)
TRV-0041070-02 50 µg

Recombinant Death Associated Protein 3 (DAP3)

Sign In for Pricing
View Details
Recombinant Death Associated Protein 3 (DAP3)
TRV-0041070-03 100 µg

Recombinant Death Associated Protein 3 (DAP3)

Sign In for Pricing
View Details