Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6)

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pleurotus ostreatus (Oyster mushroom) (White-rot fungus) . Target Name: Ostreolysin (OlyA6) . Accession Number: P83467; OlyA6. Expression Region: 2-138aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6) is a purified Recombinant Protein.

Accession Number

P83467; OlyA6

Expression Region

2-138aa

Host

E. coli

Target

Ostreolysin (OlyA6)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pleurotus ostreatus (Oyster mushroom) (White-rot fungus)

Protein Name

Recombinant Protein

AA Sequence

AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP6K1 Antibody
A26393-100UG 100 µg

IP6K1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc22a30 shRNA (UAS) - Lentiviral mouse Slc22a30 shRNA (UAS) (100)
GTR15191346 1 Vial

Lentiviral mouse Slc22a30 shRNA (UAS) - Lentiviral mouse Slc22a30 shRNA (UAS) (100)

Sign In for Pricing
View Details
BCKDK Antibody
A13922-100UL 100 µL

BCKDK Antibody

Sign In for Pricing
View Details
Human Peptidase Inhibitor 3, Skin Derived (PI3) ELISA Kit
RD-PI3-Hu-48Tests 48 Tests

Human Peptidase Inhibitor 3, Skin Derived (PI3) ELISA Kit

Sign In for Pricing
View Details
Cby1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6369703 1.0 µg DNA

Cby1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CEP72 Lentiviral Activation Particles (h2)
sc-412583-LAC-2 200 µL

CEP72 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details