Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6)

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pleurotus ostreatus (Oyster mushroom) (White-rot fungus) . Target Name: Ostreolysin (OlyA6) . Accession Number: P83467; OlyA6. Expression Region: 2-138aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 22.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6) is a purified Recombinant Protein.

Accession Number

P83467; OlyA6

Expression Region

2-138aa

Host

E. coli

Target

Ostreolysin (OlyA6)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pleurotus ostreatus (Oyster mushroom) (White-rot fungus)

Protein Name

Recombinant Protein

AA Sequence

AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli imm Protein (aa 1-87)
VAng-Lsx02447-50gEcoli 50 µg (E. coli)

Recombinant Escherichia coli imm Protein (aa 1-87)

Sign In for Pricing
View Details
LpPLA2/PLA2G7/PAF-AH Protein (N-His, Human)
P505693 100 µg

LpPLA2/PLA2G7/PAF-AH Protein (N-His, Human)

Sign In for Pricing
View Details
RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (MaxLight 750)
MBS6234931-01 0.1 mL

RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (MaxLight 750)

Sign In for Pricing
View Details
RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (MaxLight 750)
MBS6234931-02 5x 0.1 mL

RCBTB2 (RCC1 and BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, RCC1-like G Exchanging Factor, Regulator of Chromosome Condensation and BTB Domain-containing Protein 2, CHC1L, RLG) (MaxLight 750)

Sign In for Pricing
View Details
GGT1 Rabbit mAb
RDSA65947 100 µL

GGT1 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal PDCD4 Antibody [FITC]
NBP2-98857F 0.1 mL

Rabbit Polyclonal PDCD4 Antibody [FITC]

Sign In for Pricing
View Details