Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli NAD-dependent protein deacylase (cobB)

Recombinant E. coli NAD-dependent protein deacylase (cobB) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: NAD-dependent protein deacylase (cobB) . Accession Number: P75960; cobB. Expression Region: 1-242aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 34.3kda. Target Synonyms: Regulatory protein SIR2 homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli NAD-dependent protein deacylase (cobB) is a purified Recombinant Protein.

Accession Number

P75960; cobB

Expression Region

1-242aa

Host

E. coli

Target

NAD-dependent protein deacylase (cobB)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Regulatory protein SIR2 homolog

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

MEKPRVLVLTGAGISAESGIRTFRAADGLWEEHRVEDVATPEGFDRDPELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCSQSGQVLDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYPAAGFVHEAKLHGAHTVELNLEPSQVGNEFAEKYYGPASQVVPEFVEKLLKGLKAGSIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC31A (NM_001191049) Human Tagged ORF Clone
RC231472 10 µg

SEC31A (NM_001191049) Human Tagged ORF Clone

Sign In for Pricing
View Details
PIGO (GPI Ethanolamine Phosphate Transferase 3, Phosphatidylinositol-glycan Biosynthesis Class O Protein, PIG-O, UNQ632/PRO1249, DKFZp434M222, FLJ00135, MGC20536, MGC3079, RP11-182N22.4) (MaxLight 750) discontinued
131326-ML750 100 µL

PIGO (GPI Ethanolamine Phosphate Transferase 3, Phosphatidylinositol-glycan Biosynthesis Class O Protein, PIG-O, UNQ632/PRO1249, DKFZp434M222, FLJ00135, MGC20536, MGC3079, RP11-182N22.4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Luciferase of Luciferase Monoclonal Antibody
E53M02631 100 µL

Luciferase of Luciferase Monoclonal Antibody

Sign In for Pricing
View Details
Human Macrosialin (CD68) ELISA Kit
abx156733-01 96 Tests

Human Macrosialin (CD68) ELISA Kit

Sign In for Pricing
View Details
Human Macrosialin (CD68) ELISA Kit
abx156733-02 5x 96 Tests

Human Macrosialin (CD68) ELISA Kit

Sign In for Pricing
View Details
Human Macrosialin (CD68) ELISA Kit
abx156733-03 10x 96 Tests

Human Macrosialin (CD68) ELISA Kit

Sign In for Pricing
View Details