Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-5C (RAB5C)

Recombinant Human Ras-related protein Rab-5C (RAB5C) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ras-related protein Rab-5C (RAB5C) . Accession Number: P51148; RAB5C. Expression Region: 1-216aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 39.5kda. Target Synonyms: L1880RAB5L Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ras-related protein Rab-5C (RAB5C) is a purified Recombinant Protein.

Accession Number

P51148; RAB5C

Expression Region

1-216aa

Host

E. coli

Target

Ras-related protein Rab-5C (RAB5C)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

L1880RAB5L

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncarine A
MBS5763270 Inquire

Uncarine A

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody [Clone ID: OTI4E9]
TA812210S 30 µL

CINP Mouse Monoclonal Antibody [Clone ID: OTI4E9]

Sign In for Pricing
View Details
ExactaCruz® Pipette Tip Reload System, 0.1-10 μl, case
sc-201710 100 Racks/Case

ExactaCruz® Pipette Tip Reload System, 0.1-10 μl, case

Sign In for Pricing
View Details
Capsaicin Receptor, NT, Human, Control Peptide (Vanilloid Receptor 1, VR1, TrpV1)
C1078-06A 1 mg

Capsaicin Receptor, NT, Human, Control Peptide (Vanilloid Receptor 1, VR1, TrpV1)

Sign In for Pricing
View Details
Bovine MPO (myeloperoxidase) ELISA Kit
MBS7607166-01 48 Well

Bovine MPO (myeloperoxidase) ELISA Kit

Sign In for Pricing
View Details
Bovine MPO (myeloperoxidase) ELISA Kit
MBS7607166-02 96 Well

Bovine MPO (myeloperoxidase) ELISA Kit

Sign In for Pricing
View Details