Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural retina-specific leucine zipper protein (NRL)

Recombinant Human Neural retina-specific leucine zipper protein (NRL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Neural retina-specific leucine zipper protein (NRL) . Accession Number: P54845; NRL. Expression Region: 1-237aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.4kda. Target Synonyms: NRL (D14S46E) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Neural retina-specific leucine zipper protein (NRL) is a purified Recombinant Protein.

Accession Number

P54845; NRL

Expression Region

1-237aa

Host

E. coli

Target

Neural retina-specific leucine zipper protein (NRL)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NRL (D14S46E)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bestrophin-1 Rabbit Polyclonal Antibody
E28PN5662 100 µL

Bestrophin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGS13 CRISPR Activation Plasmid (m)
sc-434223-ACT 20 µg

RGS13 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Zfp511 (NM_027201) Mouse Untagged Clone
MC210998 10 µg

Zfp511 (NM_027201) Mouse Untagged Clone

Sign In for Pricing
View Details
Rat Tmem102 Pre-designed siRNA Set A
SI214664A 1 Each

Rat Tmem102 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OR5M5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1523707 1.0 µg DNA

OR5M5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
KRTAP10-8 Lentiviral Activation Particles (h)
sc-415731-LAC 200 µL

KRTAP10-8 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details