Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-18 (CLDN18), partial

Recombinant Human Claudin-18 (CLDN18), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Claudin-18 (CLDN18) . Accession Number: P56856; CLDN18. Expression Region: 28-80aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 12.1kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Claudin-18 (CLDN18), partial is a purified Recombinant Protein.

Accession Number

P56856; CLDN18

Expression Region

28-80aa

Host

E. coli

Target

Claudin-18 (CLDN18)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ELISA Kit
RE1967H-01 48 Tests

Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ELISA Kit

Sign In for Pricing
View Details
Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ELISA Kit
RE1967H-02 96 Tests

Human TSC22 (Transforming Growth Factor Beta Stimulated Protein Clone 22) ELISA Kit

Sign In for Pricing
View Details
GTPBP5 Protein Vector (Human) (pPM-C-His)
PV018980 500 ng

GTPBP5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ChAT Polyclonal Antibody, Cy7 Conjugated
bs-0042R-Cy7 100 µL

ChAT Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
MAb to Influenza A H1
MBS312282-01 1 mg

MAb to Influenza A H1

Sign In for Pricing
View Details
MAb to Influenza A H1
MBS312282-02 5x 1 mg

MAb to Influenza A H1

Sign In for Pricing
View Details