Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiogenin (Ang)

Recombinant Mouse Angiogenin (Ang) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Angiogenin (Ang) . Accession Number: P21570; Ang. Expression Region: 25-145aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 17.9kda. Target Synonyms: Angiogenin-1; Ribonuclease 5; RNase 5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Angiogenin (Ang) is a purified Recombinant Protein.

Accession Number

P21570; Ang

Expression Region

25-145aa

Host

E. coli

Target

Angiogenin (Ang)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Angiogenin-1; Ribonuclease 5; RNase 5

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C/EBP β (Phospho-Thr235) Polyclonal Antibody
orb308886-01 50 μL

C/EBP β (Phospho-Thr235) Polyclonal Antibody

Sign In for Pricing
View Details
C/EBP β (Phospho-Thr235) Polyclonal Antibody
orb308886-02 100 µL

C/EBP β (Phospho-Thr235) Polyclonal Antibody

Sign In for Pricing
View Details
C3orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0233008 1.0 µg DNA

C3orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Claudin-5 (S201) polyclonal antibody
E43S1069 100 µL

Claudin-5 (S201) polyclonal antibody

Sign In for Pricing
View Details
PE/iFluor® 647 Anti-human CD120a Antibody *H398*
112001P1-AAT 100 Tests

PE/iFluor® 647 Anti-human CD120a Antibody *H398*

Sign In for Pricing
View Details
Lentiviral mouse Ccm2 shRNA (UAS) - Lentiviral mouse Ccm2 shRNA (UAS, RFP) (25)
GTR15183995 1 Vial

Lentiviral mouse Ccm2 shRNA (UAS) - Lentiviral mouse Ccm2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details