Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor Jun (JUN)

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Transcription factor Jun (JUN) . Accession Number: P05412; JUN. Expression Region: 1-131aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 41.3kda. Target Synonyms: Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein.

Accession Number

P05412; JUN

Expression Region

1-131aa

Host

Baculovirus

Target

Transcription factor Jun (JUN)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCR (Breakpoint cluster region Protein, Renal Carcinoma Antigen NY-REN-26, BCR, BCR1, D22S11) discontinued
221039-01 50 µL

BCR (Breakpoint cluster region Protein, Renal Carcinoma Antigen NY-REN-26, BCR, BCR1, D22S11) discontinued

Sign In for Pricing
View Details
BCR (Breakpoint cluster region Protein, Renal Carcinoma Antigen NY-REN-26, BCR, BCR1, D22S11) discontinued
221039-02 100 µL

BCR (Breakpoint cluster region Protein, Renal Carcinoma Antigen NY-REN-26, BCR, BCR1, D22S11) discontinued

Sign In for Pricing
View Details
ALAD (NM_000031) Human Tagged ORF Clone
RG201545 10 µg

ALAD (NM_000031) Human Tagged ORF Clone

Sign In for Pricing
View Details
3'-O-MOE-A (Bz) -2'-CED-phosphoramidite
MF-0038369-01 10 mg

3'-O-MOE-A (Bz) -2'-CED-phosphoramidite

Sign In for Pricing
View Details
3'-O-MOE-A (Bz) -2'-CED-phosphoramidite
MF-0038369-02 100 mg

3'-O-MOE-A (Bz) -2'-CED-phosphoramidite

Sign In for Pricing
View Details
3'-O-MOE-A (Bz) -2'-CED-phosphoramidite
MF-0038369-03 25 mg

3'-O-MOE-A (Bz) -2'-CED-phosphoramidite

Sign In for Pricing
View Details