Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor Jun (JUN)

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Transcription factor Jun (JUN) . Accession Number: P05412; JUN. Expression Region: 1-131aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 41.3kda. Target Synonyms: Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Transcription factor Jun (JUN) is a purified Recombinant Protein.

Accession Number

P05412; JUN

Expression Region

1-131aa

Host

Baculovirus

Target

Transcription factor Jun (JUN)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP5 Antibody
MBS150627-01 0.1 mg

CTRP5 Antibody

Sign In for Pricing
View Details
CTRP5 Antibody
MBS150627-02 5x 0.1 mg

CTRP5 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tamm41 shRNA (UAS) - Lentiviral mouse Tamm41 shRNA (UAS) (25)
GTR15283433 1 Vial

Lentiviral mouse Tamm41 shRNA (UAS) - Lentiviral mouse Tamm41 shRNA (UAS) (25)

Sign In for Pricing
View Details
Gm8112 3'UTR Luciferase Stable Cell Line
TU108637 1.0 mL

Gm8112 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mitofusin 2 (MFN2) Antibody (FITC)
abx443306 100 µg

Mitofusin 2 (MFN2) Antibody (FITC)

Sign In for Pricing
View Details
Apol9b (NM_173743) Mouse Tagged ORF Clone Lentiviral Particle
MR215024L3V 200 µL

Apol9b (NM_173743) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details