Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudonaja textilis textilis (Eastern brown snake) . Target Name: Kunitz-type serine protease inhibitor textilinin-1. Accession Number: Q90WA1; N/A. Expression Region: 25-83aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 14.1kda. Target Synonyms: Txln-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein.

Accession Number

Q90WA1; N/A

Expression Region

25-83aa

Host

E. coli

Target

Kunitz-type serine protease inhibitor textilinin-1

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Txln-1

Species

Pseudonaja textilis textilis (Eastern brown snake)

Protein Name

Recombinant Protein

AA Sequence

KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOX2/gp91phox Rabbit Polyclonal Antibody
ER1511-34 100 µL

NOX2/gp91phox Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922724-01 48 Well

Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922724-02 96 Well

Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922724-03 5x 96 Well

Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922724-04 10x 96 Well

Porcine Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal IGSF4B/SynCAM3/CADM3 Antibody (3) [DyLight 350]
NBP2-89843UV 0.1 mL

Rabbit Monoclonal IGSF4B/SynCAM3/CADM3 Antibody (3) [DyLight 350]

Sign In for Pricing
View Details