Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudonaja textilis textilis (Eastern brown snake) . Target Name: Kunitz-type serine protease inhibitor textilinin-1. Accession Number: Q90WA1; N/A. Expression Region: 25-83aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 14.1kda. Target Synonyms: Txln-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein.

Accession Number

Q90WA1; N/A

Expression Region

25-83aa

Host

E. coli

Target

Kunitz-type serine protease inhibitor textilinin-1

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Txln-1

Species

Pseudonaja textilis textilis (Eastern brown snake)

Protein Name

Recombinant Protein

AA Sequence

KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Swine H1N1 Hemagglutinin Antibody
NBP2-41109-0.025mg 0.025 mg

Rabbit Polyclonal Swine H1N1 Hemagglutinin Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HIPK1 Antibody (OTI5F1) [Biotin]
NBP2-72460B 0.1 mL

Mouse Monoclonal HIPK1 Antibody (OTI5F1) [Biotin]

Sign In for Pricing
View Details
Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody
TA360026 100 µL

Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal PTCHD2 Antibody
AMR09591G 0.1 mg

Polyclonal PTCHD2 Antibody

Sign In for Pricing
View Details
TUB (NM_177972) Human Tagged ORF Clone Lentiviral Particle
RC214538L3V 200 µL

TUB (NM_177972) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ces1a (NM_001013764) Mouse Tagged Lenti ORF Clone
MR208918L3 10 µg

Ces1a (NM_001013764) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details