Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudonaja textilis textilis (Eastern brown snake) . Target Name: Kunitz-type serine protease inhibitor textilinin-1. Accession Number: Q90WA1; N/A. Expression Region: 25-83aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 14.1kda. Target Synonyms: Txln-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1 is a purified Recombinant Protein.

Accession Number

Q90WA1; N/A

Expression Region

25-83aa

Host

E. coli

Target

Kunitz-type serine protease inhibitor textilinin-1

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Txln-1

Species

Pseudonaja textilis textilis (Eastern brown snake)

Protein Name

Recombinant Protein

AA Sequence

KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LITAF Antibody (1F9) [DyLight 550]
NBP1-30250R 0.1 mL

Mouse Monoclonal LITAF Antibody (1F9) [DyLight 550]

Sign In for Pricing
View Details
MKX/Mohawk homeobox Polyclonal Antibody
MBS9237795-01 0.1 mL

MKX/Mohawk homeobox Polyclonal Antibody

Sign In for Pricing
View Details
MKX/Mohawk homeobox Polyclonal Antibody
MBS9237795-02 5x 0.1 mL

MKX/Mohawk homeobox Polyclonal Antibody

Sign In for Pricing
View Details
PcDNA3.1-GFP (156-238AA) -GSDMD
PPL00857-2c 1 Each

PcDNA3.1-GFP (156-238AA) -GSDMD

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIH subunit 4 (GTF2H4)
MBS1322324-01 0.02 mg (E-Coli)

Recombinant Human General transcription factor IIH subunit 4 (GTF2H4)

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIH subunit 4 (GTF2H4)
MBS1322324-02 0.02 mg (Yeast)

Recombinant Human General transcription factor IIH subunit 4 (GTF2H4)

Sign In for Pricing
View Details