Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) . Target Name: Pertussis toxin subunit 1 (ptxA) . Accession Number: P04977; ptxA. Expression Region: 35-269aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 30.2kda. Target Synonyms: Islet-activating protein S1; IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-) Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein.

Accession Number

P04977; ptxA

Expression Region

35-269aa

Host

E. coli

Target

Pertussis toxin subunit 1 (ptxA)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Islet-activating protein S1; IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)

Species

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Protein Name

Recombinant Protein

AA Sequence

DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Catalase Antibody (OTI1B8) - Azide and BSA Free
NBP2-70342 100 µg

Mouse Monoclonal Catalase Antibody (OTI1B8) - Azide and BSA Free

Ask
View Details
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49
MBS6201672-01 0.1 mL

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49

Ask
View Details
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49
MBS6201672-02 5x 0.1 mL

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49

Ask
View Details
Human ACKR4 Knockout A549 cell line
GTR15417597 1 Vial

Human ACKR4 Knockout A549 cell line

Ask
View Details
NCS1 Rabbit Polyclonal Antibody
BT-AP11507-01 20 µL

NCS1 Rabbit Polyclonal Antibody

Ask
View Details
NCS1 Rabbit Polyclonal Antibody
BT-AP11507-02 50 µL

NCS1 Rabbit Polyclonal Antibody

Ask
View Details