Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

Recombinant Macadamia integrifolia Antimicrobial peptide 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macadamia integrifolia (Macadamia nut) . Target Name: Antimicrobial peptide 1. Accession Number: P80915; N/A. Expression Region: 27-102aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 15.0kda. Target Synonyms: AMP1; MiAMP1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macadamia integrifolia Antimicrobial peptide 1 is a purified Recombinant Protein.

Accession Number

P80915; N/A

Expression Region

27-102aa

Host

E. coli

Target

Antimicrobial peptide 1

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Kits, Lysates, Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AMP1; MiAMP1

Species

Macadamia integrifolia (Macadamia nut)

Protein Name

Recombinant Protein

AA Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP10 Recombinant Protein Antigen
NBP1-84159PEP 0.1 mL

LRP10 Recombinant Protein Antigen

Sign In for Pricing
View Details
Mouse Angiotensin I Converting Enzyme (ACE) CLIA Kit
EKU08771 96 Tests

Mouse Angiotensin I Converting Enzyme (ACE) CLIA Kit

Sign In for Pricing
View Details
CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28) (FITC)
124688-FITC 100 µL

CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28) (FITC)

Sign In for Pricing
View Details
Pemetrexed disodium hemipenta hydrate 100mg
A15207-100 100 mg

Pemetrexed disodium hemipenta hydrate 100mg

Sign In for Pricing
View Details
Slc16a6 3'UTR Lenti-reporter-Luc Vector
43902084 1.0 µg

Slc16a6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TACC2 CRISPR Activation Plasmid (h2)
sc-405864-ACT-2 20 µg

TACC2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details