Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) . Target Name: immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env) . Accession Number: P04578; env. Expression Region: 33-511aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 69.7kda. Target Synonyms: Env polyprotein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial is a purified Recombinant Protein.

Accession Number

P04578; env

Expression Region

33-511aa

Host

E. coli

Target

Immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Env polyprotein

Species

Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

Protein Name

Recombinant Protein

AA Sequence

KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoconazole nitrate
C08649-50mg 50 mg

Isoconazole nitrate

Sign In for Pricing
View Details
PTPRC (Protein Tyrosine Phosphatase, Receptor Type, C, B220, CD45, CD45R, GP180, LCA, LY5, T200) (PE)
MBS6187436-01 0.1 mL

PTPRC (Protein Tyrosine Phosphatase, Receptor Type, C, B220, CD45, CD45R, GP180, LCA, LY5, T200) (PE)

Sign In for Pricing
View Details
PTPRC (Protein Tyrosine Phosphatase, Receptor Type, C, B220, CD45, CD45R, GP180, LCA, LY5, T200) (PE)
MBS6187436-02 5x 0.1 mL

PTPRC (Protein Tyrosine Phosphatase, Receptor Type, C, B220, CD45, CD45R, GP180, LCA, LY5, T200) (PE)

Sign In for Pricing
View Details
At4g35733 Antibody
orb788111 2 mg

At4g35733 Antibody

Sign In for Pricing
View Details
Rabbit Anti Bovine Haptoglobin
18120 0.1 mg

Rabbit Anti Bovine Haptoglobin

Sign In for Pricing
View Details
Rat Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit
DLR-HSP90aA1-Ra-96T 96 Tests

Rat Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit

Sign In for Pricing
View Details