Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) . Target Name: immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env) . Accession Number: P04578; env. Expression Region: 33-511aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 69.7kda. Target Synonyms: Env polyprotein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial is a purified Recombinant Protein.

Accession Number

P04578; env

Expression Region

33-511aa

Host

E. coli

Target

Immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

69.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Env polyprotein

Species

Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

Protein Name

Recombinant Protein

AA Sequence

KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit
MBS7217859-01 48 Well

Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit
MBS7217859-02 96 Well

Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit
MBS7217859-03 5x 96 Well

Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit
MBS7217859-04 10x 96 Well

Rabbit Calcium release-activated calcium channel protein 1 (ORAI1) ELISA Kit

Sign In for Pricing
View Details
WNT10B Antibody
A46389-100UL 100 µL

WNT10B Antibody

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Coagulation Factor II (F2)
MBS2048106-01 0.1 mL

FITC-Linked Monoclonal Antibody to Coagulation Factor II (F2)

Sign In for Pricing
View Details