Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Glucocorticoid receptor (NR3C1) . Accession Number: P04150; NR3C1. Expression Region: 521-777aa. Tag Info: N-terminal 10xHis-GST-tagged. Theoretical MW: 61.3kda. Target Synonyms: Nuclear receptor subfamily 3 group C member 1 GRL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein.

Accession Number

P04150; NR3C1

Expression Region

521-777aa

Host

E. coli

Target

Glucocorticoid receptor (NR3C1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nuclear receptor subfamily 3 group C member 1 GRL

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12296116 3x 1.0 µg

Arhgap27 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human C4orf46 Protein
E30P7761 20 µg

Recombinant Human C4orf46 Protein

Sign In for Pricing
View Details
(5S) -N- (5-Amino-1-carboxypentyl) iminodiacetic Acid
sc-211989 100 mg

(5S) -N- (5-Amino-1-carboxypentyl) iminodiacetic Acid

Sign In for Pricing
View Details
Mouse Noct activation kit by CRISPRa
GA200590 1 Kit

Mouse Noct activation kit by CRISPRa

Sign In for Pricing
View Details
RBX1 Protein Vector (Rat) (pPM-C-HA)
PV298560 500 ng

RBX1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
VEGF Receptor 2 Antibody
orb1318280 100 µL

VEGF Receptor 2 Antibody

Sign In for Pricing
View Details